Atlas Antibodies Anti-GALNTL5 Antibody
Atlas Antibodies

Atlas Antibodies Anti-GALNTL5 Antibody

✦상품 한눈에 보기

Human GALNTL5 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 WB에서 검증됨. Rabbit 유래 IgG, PrEST 항원으로 정제. Orthogonal 및 recombinant expression validation 제공. 인간 반응성 확인, 연구용으로 적합.

브랜드: Atlas Antibodies
카테고리 상품 전체보기브랜드 상품 전체보기
#Antibodies#Atlas Antibodies

상품 옵션 정보

다양한 옵션의 상품 정보와 가격을 확인하세요

소모품
HPA011140-100
Atlas Antibodies HPA011140-100 Anti-GALNTL5 Antibody, polypeptide N-acetylgalactosaminyltransferase-like 5 100ul
CAS: -단위: 100ul
재고문의재고: -
728,000원
(VAT포함)800,800원
HPA011140-25
Atlas Antibodies HPA011140-25 Anti-GALNTL5 Antibody, polypeptide N-acetylgalactosaminyltransferase-like 5 25ul
CAS: -단위: 25ul
재고문의재고: -
528,000원
(VAT포함)580,800원
소모품
HPA011140-100
재고문의재고: -
Atlas Antibodies HPA011140-100 Anti-GALNTL5 Antibody, polypeptide N-acetylgalactosaminyltransferase-like 5 100ul
CAS: -단위: 100ul
728,000원
(VAT포함)800,800원
HPA011140-25
재고문의재고: -
Atlas Antibodies HPA011140-25 Anti-GALNTL5 Antibody, polypeptide N-acetylgalactosaminyltransferase-like 5 25ul
CAS: -단위: 25ul
528,000원
(VAT포함)580,800원

✨AI 추천 연관 상품

AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요

연관 상품을 찾고 있습니다...

Anti-GALNTL5 Antibody

polypeptide N-acetylgalactosaminyltransferase-like 5

  • IHC Orthogonal Validation
    Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

  • WB Recombinant Expression Validation
    Recombinant expression validation in WB using target protein overexpression.

Product Description

Polyclonal Antibody against Human GALNTL5

Alternative Gene Names: GalNAc-T5L, GALNT15
Target Protein: polypeptide N-acetylgalactosaminyltransferase-like 5
Target Gene: GALNTL5
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence 

HCEVNRVWLEPLLHAIAKDPKMVVCPLIDVIDDRTLEYKPSPLVRGTFDWNLQFKWDNVFSYEMDGPEGSTKPIRSPAMSGGIFAIRRHYFNEIGQYDKDMD

Open Datasheet

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000040301 82%
Mouse ENSMUSG00000028938 76%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
WB Recombinant Expression Validation

🏷️Atlas Antibodies 상품 둘러보기

동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies Anti-GALT Antibody

Atlas Antibodies

Atlas Antibodies Anti-GALT Antibody

528,000원

Atlas Antibodies Anti-GALNT6 Antibody

Atlas Antibodies

Atlas Antibodies Anti-GALNT6 Antibody

528,000원

Atlas Antibodies Anti-GALNTL5 Antibody

Atlas Antibodies

Atlas Antibodies Anti-GALNTL5 Antibody

528,000원

Atlas Antibodies Anti-GALR1 Antibody

Atlas Antibodies

Atlas Antibodies Anti-GALR1 Antibody

528,000원

Atlas Antibodies Anti-GALNT9 Antibody

Atlas Antibodies

Atlas Antibodies Anti-GALNT9 Antibody

528,000원

배송/결제/교환/반품 안내

배송 정보

기본 배송비
  • - 배송비 3,850원 (부가세 포함)
  • - 10만원 이상 구매시 배송비 무료
  • - 도서산간 및 제주를 포함한 일부 지역 추가비용 발생
  • - 장비의 경우 추가 배송비 및 설치비가 청구 될 수 있습니다
교환/반품 배송비
  • - 상품 별로 상이
착불 배송비
  • - 착불 적용 상품에 개별 부과 (상품 별로 상이)
교환/반품 배송비
  • - 상품 별로 상이

결제 및 환불 안내

결제수단
  • - 신용카드
  • - 가상계좌
  • - 연구비카드
  • - 세금계산서 (기업은행 033-502993-01-019)
  • - 세금계산서 (신한은행 100-032-703829)
  • - 상품 결제 후 최대 60일 이내 제공 완료
취소
  • - 취소 접수 후 3 ~ 5일 이내 환불 처리
반품
  • - 반품 접수 후 3 ~ 5일 이내 환불 처리
환급
  • - 회사는 회원이 구매신청한 상품 등이 품절 등의 사유로 인도 또는 제공할 수 없을 때에는 지체 없이 그 사유를 회원에게 통지하고,
      사전에 상품 등의 대금을 받은 경우에는 대금을 받은 날로부터 3영업일 이내에 환급하거나 환급에 필요한 조치를 취합니다.

교환 및 반품 접수

교환 및 반품 접수 기한
  • - 상품 수령일로부터 7일 이내
교환 및 반품 접수가 가능한 경우
  • - 제품의 하자는 없지만, 다른 상품으로 교환하거나 반품 원하는 경우
     (배송비 고객 부담)
  • - 상품자체 불량 및 하자에 의한 경우
  • - 상품 오배송에 의한 경우
교환 및 반품 접수가 불가능한 경우
  • - 상품 수령 후 7일을 초과한 경우
  • - 개별 포장 상품의 포장을 훼손한 경우
  • - 고객의 고의적인 귀책으로 상품가치가 훼손된 경우
  • - 주문제작을 통해서 제품을 생산하는 경우
  • - 주문 당시 재고가 없어서 해외를 통해 제품을 수입해서 구매하는 경우

교환 및 반품 신청

교환 절차
  • - 상품 불량/오배송/상품파손
  • - 전화(02-585-1342) 또는 info@cacheby.com에 상품교환 접수
반품 절차
  • - 반품할 품목을 확인 후 info@cacheby.com로 반품 신청 (수령 후 7일 이내 가능하며 이후 불가)
  • - 전달드린 주문번호와 함께 반품 상품을 포장
     (포장을 꼼꼼하게 해주셔야 반품 상품 손상에 따른 불이익이 없습니다.)
  • - 택배회사 방문 시 반품 상품 전달
     (택배사의 반송장은 상품 교환이 완료될 때까지 보관해주시기 바랍니다.)
  • - 회수된 제품 확인 후 하자없을시 배송비를 제외하고 환불 처리 진행
     (환불 처리 후 입금까지 최대 2주까지 소요될 수 있습니다.)

문의 0