Atlas Antibodies Anti-GALNTL5 Antibody

상품 한눈에 보기

Human GALNTL5 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 WB에서 검증됨. Rabbit 유래 IgG, PrEST 항원으로 정제. Orthogonal 및 recombinant expression validation 제공. 인간 반응성 확인, 연구용으로 적합.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA011140-100 Anti-GALNTL5 Antibody, polypeptide N-acetylgalactosaminyltransferase-like 5 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA011140-25 Anti-GALNTL5 Antibody, polypeptide N-acetylgalactosaminyltransferase-like 5 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-GALNTL5 Antibody

Anti-GALNTL5 Antibody

polypeptide N-acetylgalactosaminyltransferase-like 5

Recommended Applications

IHC Orthogonal Validation
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB Recombinant Expression Validation
Recombinant expression validation in WB using target protein overexpression.

Product Description

Polyclonal Antibody against Human GALNTL5

Alternative Gene Names: GalNAc-T5L, GALNT15
Target Protein: polypeptide N-acetylgalactosaminyltransferase-like 5
Target Gene: GALNTL5
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

HCEVNRVWLEPLLHAIAKDPKMVVCPLIDVIDDRTLEYKPSPLVRGTFDWNLQFKWDNVFSYEMDGPEGSTKPIRSPAMSGGIFAIRRHYFNEIGQYDKDMD

Open Datasheet

Verified Species Reactivity

Human

Interspecies Information

Species	Gene ID	Sequence Identity
Rat	ENSRNOG00000040301	82%
Mouse	ENSMUSG00000028938	76%

Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand