CacheBy
Atlas Antibodies Anti-GALNT6 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GALNT6 Antibody

상품 한눈에 보기

인간 GALNT6 단백질을 표적으로 하는 고품질 폴리클로날 항체로, IHC 및 WB 분석에 적합합니다. RNA-seq 데이터 기반의 오쏘고날 검증을 거쳤으며, 친화 정제된 Rabbit IgG 형태로 제공됩니다. 높은 특이성과 재현성을 보장합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA017086-100 Anti-GALNT6 Antibody, polypeptide N-acetylgalactosaminyltransferase 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA017086-25 Anti-GALNT6 Antibody, polypeptide N-acetylgalactosaminyltransferase 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GALNT6 Antibody

Anti-GALNT6 Antibody

Target: polypeptide N-acetylgalactosaminyltransferase 6
Supplier: Atlas Antibodies


  • IHC Orthogonal Validation: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB Orthogonal Validation: Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Product Description

Polyclonal Antibody against Human GALNT6

Alternative Gene Names

GalNAc-T6

Open Datasheet (PDF)


Specifications

항목 내용
Target Protein polypeptide N-acetylgalactosaminyltransferase 6
Target Gene GALNT6
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence LIMYSCHGLGGNQYFEYTTQRDLRHNIAKQLCLHVSKGALGLGSCHFTGKNSQVPKDEEWELAQDQLIRNSGSGTCLTSQDKKPAMAPCNPSDPHQLWLFV
Verified Species Reactivity Human
Interspecies Identity Mouse (85%), Rat (83%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Material Safety Data Sheet


제품 이미지

Enhanced Validation
IHC Orthogonal
WB Orthogonal

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.