
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-GALT Antibody
상품 한눈에 보기
Human GALT 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에 적합합니다. Rabbit에서 생산되었으며, PrEST 항원으로 정제되었습니다. Human, Mouse, Rat 종에 반응하며, 고품질 단백질 발현 검증용으로 사용됩니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA005729-100 Anti-GALT Antibody, galactose-1-phosphate uridylyltransferase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA005729-25 Anti-GALT Antibody, galactose-1-phosphate uridylyltransferase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-GALT Antibody
Anti-GALT Antibody
Target: galactose-1-phosphate uridylyltransferase (GALT)
Recommended Applications
- IHC (Immunohistochemistry) – Independent validation by comparing antibodies targeting different epitopes of the same protein
- WB (Western Blot)
Product Description
Polyclonal antibody against human GALT.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | galactose-1-phosphate uridylyltransferase |
| Target Gene | GALT |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | RANDHQHIRYNPLQDEWVLVSAHRMKRPWQGQVEPQLLKTVPRHDPLNPLCPGAIRANGEVNPQYDSTFLFDNDFPALQPDAPSPGPSDHPLFQAKSARGVCKVMCFHPWSD |
Species Reactivity
- Human
- Mouse
- Rat
Interspecies Information:
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000036073 (92%)
- Rat ENSRNOG00000014766 (91%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



