
Atlas Antibodies Anti-GALR1 Antibody
상품 한눈에 보기
인간 GALR1 단백질을 인식하는 토끼 유래 폴리클로날 항체로, GALNR1 유전자에 대응합니다. 면역세포화학(ICC) 등 다양한 응용에 적합하며, 고순도 친화정제 방식으로 제조되었습니다. 휴먼 반응성 검증 완료.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-GALR1 Antibody
Target Information
- Target Protein: Galanin receptor 1
- Target Gene: GALR1
- Alternative Gene Names: GALNR, GALNR1
Recommended Applications
면역세포화학(ICC) 등 다양한 연구 응용에 적합합니다.
Product Description
Polyclonal Antibody against Human GALR1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:MELAVGNLSEGNASWPEPPAPEPGPLFGIGVENFVT
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000024553 (81%)
- Rat ENSRNOG00000016654 (81%)
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen |
| Verified Reactivity | Human |
| Alternative Gene Names | GALNR, GALNR1 |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용에 대한 최적 농도 및 조건은 사용자가 직접 결정해야 합니다.
Reference
Open Datasheet (PDF)
Material Safety Data Sheet
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-GALNT6 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GALNTL5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GALR1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GALNT9 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GALNTL6 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.