
Atlas Antibodies Anti-GALNTL6 Antibody
상품 한눈에 보기
인간 GALNTL6 단백질을 표적으로 하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. IHC와 WB에 적합하며, PrEST 항원으로 정제되었습니다. 높은 특이성과 재현성을 제공하여 단백질 발현 연구에 활용 가능합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-GALNTL6 Antibody
Target: polypeptide N-acetylgalactosaminyltransferase-like 6
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against Human GALNTL6
Alternative Gene Names
- GalNAc-T6L
- GALNT17
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | polypeptide N-acetylgalactosaminyltransferase-like 6 |
| Target Gene | GALNTL6 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000096914 (93%), Rat ENSRNOG00000002488 (37%) |
Antigen Sequence:
DKHLVKSAEPGEQQTFPLGLGDGQFYSWTDGLRRKDWHDYESIQKEAMRSGKGEHGKPYPLTEEDHDDSAYRENGFNIFVSN
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-GALR1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GALNT9 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GALNTL6 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GALNT8 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GALNT8 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.