
Atlas Antibodies Anti-GALK1 Antibody
인간 GALK1 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원으로 특이적 정제되어 높은 특이성과 재현성 제공. 토끼 유래 IgG 형식으로 인체 반응 검증 완료.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-GALK1 Antibody
Target Protein: galactokinase 1 (GALK1)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot) — Independent validation comparing antibodies targeting different epitopes of the protein
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against human GALK1.
Alternative Gene Name: GALK
Clonality: Polyclonal
Isotype: IgG
Host: Rabbit
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
GEHTDYNQGLVLPMALELMTVLVGSPRKDGLVSLLTTSEGADEPQRLQFPLPTAQRSLEPGTPRWANYVKGVIQYYPAAPLPGFSAVVVSSVPLGGGLSSSASLEVATYTFLQQLCPDSGTIAARAQVCQQAEHSFAGMPCGIMDQFI
Species Reactivity
| Species | Identity (%) | Gene ID |
|---|---|---|
| Human | Verified | GALK1 |
| Rat | 89 | ENSRNOG00000006359 |
| Mouse | 89 | ENSMUSG00000020766 |
Buffer Composition
| Component | Description |
|---|---|
| Glycerol | 40% |
| PBS | pH 7.2 |
| Sodium Azide | 0.02% (preservative) |
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-GALK2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GALK1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GALK1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GAL3ST4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GAL3ST4 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|