
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-GALK1 Antibody
상품 한눈에 보기
인간 GALK1 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원으로 특이적 정제되어 높은 특이성과 재현성 제공. 토끼 유래 IgG 형식으로 인체 반응 검증 완료.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA007094-100 Anti-GALK1 Antibody, galactokinase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA007094-25 Anti-GALK1 Antibody, galactokinase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-GALK1 Antibody
Anti-GALK1 Antibody
Target Protein: galactokinase 1 (GALK1)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot) — Independent validation comparing antibodies targeting different epitopes of the protein
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against human GALK1.
Alternative Gene Name: GALK
Clonality: Polyclonal
Isotype: IgG
Host: Rabbit
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
GEHTDYNQGLVLPMALELMTVLVGSPRKDGLVSLLTTSEGADEPQRLQFPLPTAQRSLEPGTPRWANYVKGVIQYYPAAPLPGFSAVVVSSVPLGGGLSSSASLEVATYTFLQQLCPDSGTIAARAQVCQQAEHSFAGMPCGIMDQFI
Species Reactivity
| Species | Identity (%) | Gene ID |
|---|---|---|
| Human | Verified | GALK1 |
| Rat | 89 | ENSRNOG00000006359 |
| Mouse | 89 | ENSMUSG00000020766 |
Buffer Composition
| Component | Description |
|---|---|
| Glycerol | 40% |
| PBS | pH 7.2 |
| Sodium Azide | 0.02% (preservative) |
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



