CacheBy
Atlas Antibodies Anti-GALK1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GALK1 Antibody

상품 한눈에 보기

인간 GALK1 단백질을 표적으로 하는 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. 토끼 유래 IgG 항체로 PrEST 항원으로 정제됨. 인간에 높은 특이성 및 검증된 교차 반응 데이터 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA016960-100 Anti-GALK1 Antibody, galactokinase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA016960-25 Anti-GALK1 Antibody, galactokinase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GALK1 Antibody

Anti-GALK1 Antibody

Target Protein: galactokinase 1
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB, Independent validation)
  • Immunocytochemistry (ICC)

Validation Note:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.


Product Description

Polyclonal antibody against Human GALK1


Alternative Gene Names

  • GALK

Open Datasheet (PDF)


Specifications

항목 내용
Target Protein galactokinase 1
Target Gene GALK1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000020766 (89%)
Rat ENSRNOG00000006359 (89%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Antigen Sequence

GEHTDYNQGLVLPMALELMTVLVGSPRKDGLVSLLTTSEGADEPQRLQFPLPTAQRSLEPGTPRWANYVKGVIQYYPAAPLPGFSAVVVSSVPLGGGLSSSASLEVATYTFLQQLCPDSGTIAARAQVCQQAEHSFAGMPCGIMDQFI

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Independent
Independent Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.