CacheBy
Atlas Antibodies Anti-GAL3ST4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GAL3ST4 Antibody

상품 한눈에 보기

인간 GAL3ST4 단백질을 표적으로 하는 폴리클로날 항체입니다. IHC 및 WB 응용에 적합하며, PrEST 항원으로 친화 정제되었습니다. 토끼 유래 IgG 형식으로 높은 특이성과 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA038138-100 Anti-GAL3ST4 Antibody, galactose-3-O-sulfotransferase 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038138-25 Anti-GAL3ST4 Antibody, galactose-3-O-sulfotransferase 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GAL3ST4 Antibody

Anti-GAL3ST4 Antibody

Target Information

  • Target Protein: galactose-3-O-sulfotransferase 4
  • Target Gene: GAL3ST4
  • Alternative Gene Names: FLJ12116
  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human GAL3ST4.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

LLADALCWGLDDVVGFMHNAQAGHKQGLSTVSNSGLTAEDRQLTARARAWNNLDWALYVHFNRSLWARIEKYGQGRLQTAVAE

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000075593): 76%
  • Rat (ENSRNOG00000001375): 76%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.