CacheBy
Atlas Antibodies Anti-GALK2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GALK2 Antibody

상품 한눈에 보기

인간 GALK2 단백질에 특이적인 폴리클로날 항체로, IHC 및 WB 적용에 적합합니다. 토끼에서 생산되었으며, PrEST 항원으로 친화 정제되었습니다. PBS 기반 버퍼와 글리세롤 보존액을 포함하며, 높은 종 간 반응 특이성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA048267-100 Anti-GALK2 Antibody, galactokinase 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA048267-25 Anti-GALK2 Antibody, galactokinase 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GALK2 Antibody

Anti-GALK2 Antibody

Target Protein: galactokinase 2
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human GALK2.


Alternative Gene Names

  • GK2

Open Datasheet


Antigen Information

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

LVDICRKFGAQGSRLTGAGWGGCTVSMVPADKLPSFLANVHKAYYQRSDGSLAPEKQSLFATKPGGGALVLLE

Verified Species Reactivity

  • Human

Interspecies Sequence Identity:
| Species | Gene ID | Identity |
|----------|----------|-----------|
| Rat | ENSRNOG00000009289 | 81% |
| Mouse | ENSMUSG00000027207 | 79% |


Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Safety Data Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
WB Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.