원본
Thermo Fisher Scientific AMPK Beta-2 Polyclonal Antibody
상품 한눈에 보기
AMPK 베타-2 단백질을 인식하는 Thermo Fisher Scientific의 폴리클로날 항체로, Western blot, IHC, ICC, Flow Cytometry 등 다양한 응용에 적합합니다. 인간, 마우스, 랫트에 반응하며, 항원 친화 크로마토그래피로 정제된 고순도 항체입니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 02. 오후 05:44
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA579866 AMPK Beta-2 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원
Thermo Fisher Scientific · Thermo Fisher Scientific AMPK Beta-2 Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 2 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human AMPK beta 2 (56–89 aa, DKEFVSWQQDLEDSVKPTQQARPTVIRWSEGGKE) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | –20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746981 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
AMPK Beta 2는 AMP-activated protein kinase (AMPK)의 조절 서브유닛으로, AMPK는 α 촉매 서브유닛과 비촉매성 β, γ 서브유닛으로 구성된 이형삼합체입니다.
AMPK는 세포 내 에너지 상태를 감지하는 효소로, 대사 스트레스에 반응하여 활성화되며, 지방산 및 콜레스테롤 생합성의 핵심 효소인 ACC와 HMGCR을 인산화 및 불활성화합니다.
이 서브유닛은 AMPK 활성을 양성으로 조절할 수 있으며, 미리스토일화 및 인산화가 효소 활성과 세포 내 위치에 영향을 미치는 것으로 알려져 있습니다. 또한 AMPK 복합체의 연결을 매개하는 어댑터 역할을 할 수 있습니다.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific PKC beta-1 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific PRKAR1A Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific Perforin Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific PPT1 Polyclonal Antibody568,000원VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.