Thermo Fisher Scientific AMPK Beta-2 Polyclonal Antibody
AMPK 베타-2 단백질을 인식하는 Thermo Fisher Scientific의 폴리클로날 항체로, Western blot, IHC, ICC, Flow Cytometry 등 다양한 응용에 적합합니다. 인간, 마우스, 랫트에 반응하며, 항원 친화 크로마토그래피로 정제된 고순도 항체입니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 2 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human AMPK beta 2 (56–89 aa, DKEFVSWQQDLEDSVKPTQQARPTVIRWSEGGKE) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | –20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746981 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
AMPK Beta 2는 AMP-activated protein kinase (AMPK)의 조절 서브유닛으로, AMPK는 α 촉매 서브유닛과 비촉매성 β, γ 서브유닛으로 구성된 이형삼합체입니다.
AMPK는 세포 내 에너지 상태를 감지하는 효소로, 대사 스트레스에 반응하여 활성화되며, 지방산 및 콜레스테롤 생합성의 핵심 효소인 ACC와 HMGCR을 인산화 및 불활성화합니다.
이 서브유닛은 AMPK 활성을 양성으로 조절할 수 있으며, 미리스토일화 및 인산화가 효소 활성과 세포 내 위치에 영향을 미치는 것으로 알려져 있습니다. 또한 AMPK 복합체의 연결을 매개하는 어댑터 역할을 할 수 있습니다.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific PKC beta-1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific PRKAR1A Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific AMPK Beta-2 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Perforin Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific PPT1 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|