CacheBy
Thermo Fisher Scientific AMPK Beta-2 Polyclonal Antibody
원본

Thermo Fisher Scientific AMPK Beta-2 Polyclonal Antibody

상품 한눈에 보기

AMPK 베타-2 단백질을 인식하는 Thermo Fisher Scientific의 폴리클로날 항체로, Western blot, IHC, ICC, Flow Cytometry 등 다양한 응용에 적합합니다. 인간, 마우스, 랫트에 반응하며, 항원 친화 크로마토그래피로 정제된 고순도 항체입니다.

판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 02. 오후 05:44
Thermo Fisher Scientific PA579866 AMPK Beta-2 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원

Thermo Fisher Scientific · Thermo Fisher Scientific AMPK Beta-2 Polyclonal Antibody

Applications and Tested Dilution

Application Tested Dilution
Western Blot (WB) 0.1–0.5 µg/mL
Immunohistochemistry (Paraffin) (IHC (P)) 0.5–1 µg/mL
Immunocytochemistry (ICC/IF) 2 µg/mL
Flow Cytometry (Flow) 1–3 µg/1×10⁶ cells

Product Specifications

항목 내용
Species Reactivity Human, Mouse, Rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human AMPK beta 2 (56–89 aa, DKEFVSWQQDLEDSVKPTQQARPTVIRWSEGGKE)
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Antigen affinity chromatography
Storage Buffer PBS with 5 mg BSA
Contains 0.05 mg sodium azide
Storage Conditions –20°C
Shipping Conditions Ambient (domestic); Wet ice (international)
RRID AB_2746981

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Target Information

AMPK Beta 2는 AMP-activated protein kinase (AMPK)의 조절 서브유닛으로, AMPK는 α 촉매 서브유닛과 비촉매성 β, γ 서브유닛으로 구성된 이형삼합체입니다.
AMPK는 세포 내 에너지 상태를 감지하는 효소로, 대사 스트레스에 반응하여 활성화되며, 지방산 및 콜레스테롤 생합성의 핵심 효소인 ACC와 HMGCR을 인산화 및 불활성화합니다.
이 서브유닛은 AMPK 활성을 양성으로 조절할 수 있으며, 미리스토일화 및 인산화가 효소 활성과 세포 내 위치에 영향을 미치는 것으로 알려져 있습니다. 또한 AMPK 복합체의 연결을 매개하는 어댑터 역할을 할 수 있습니다.


For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.