
Thermo Fisher Scientific VRK1 Polyclonal Antibody
Rabbit polyclonal antibody against human VRK1 for Western blot applications. High purity via antigen affinity chromatography. Lyophilized form, reconstitutable to 500 µg/mL. Suitable for research use only.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
- Western Blot (WB): Tested dilution 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human VRK1 (292–329aa EKNKPGEIAKYMETVKLLDYTEKPLYENLRDILLQGLK) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage conditions | −20°C |
| Shipping conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2747336 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Human vaccinia-related kinase 1 (VRK1) is a kinase related to a poxvirus kinase and distantly to the casein kinase 1 family. VRK1 shows strong autophosphorylating activity on several Ser and Thr residues and acts as an upstream regulator of p53, forming part of a new signaling pathway.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific WASP Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific VWF Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific VRK1 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific Villin Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific VEGFB Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|