
원본
Thermo Fisher Scientific VRK1 Polyclonal Antibody
상품 한눈에 보기
Rabbit polyclonal antibody against human VRK1 for Western blot applications. High purity via antigen affinity chromatography. Lyophilized form, reconstitutable to 500 µg/mL. Suitable for research use only.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 01. 오후 06:51
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA580222 VRK1 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원
Thermo Fisher Scientific · Thermo Fisher Scientific VRK1 Polyclonal Antibody
Applications
- Western Blot (WB): Tested dilution 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human VRK1 (292–329aa EKNKPGEIAKYMETVKLLDYTEKPLYENLRDILLQGLK) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage conditions | −20°C |
| Shipping conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2747336 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Human vaccinia-related kinase 1 (VRK1) is a kinase related to a poxvirus kinase and distantly to the casein kinase 1 family. VRK1 shows strong autophosphorylating activity on several Ser and Thr residues and acts as an upstream regulator of p53, forming part of a new signaling pathway.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.
