
Thermo Fisher Scientific Villin Polyclonal Antibody
Villin 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody로, Western blot, IHC, Flow Cytometry에 적합. 인간, 마우스, 랫트 반응성. 항원 친화 크로마토그래피로 정제되었으며, PBS/BSA 버퍼에 보관. 연구용 전용.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| Property | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to human Villin (C-terminus, 770–799 aa: EQLVNKPVEELPEGVDPSRKEEHLSIEDFT) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | −20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2747335 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Villin은 위장관 및 신장의 brush border 미세융모의 actin core bundle과 관련된 세포골격 단백질입니다. Ca²⁺ 및 인지질에 의해 조절되는 방식으로 actin과 상호작용할 수 있습니다. Villin은 위장관 및 췌장의 선암종에 대한 매우 특이적인 마커이며, 일부 Merkel 세포종 및 폐, 전립선, 난소, 신장의 선암종에서도 발현됩니다.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음)
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific VWF Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific VRK1 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific Villin Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific VEGFB Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific VCP Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|