원본
Thermo Fisher Scientific Villin Polyclonal Antibody
상품 한눈에 보기
Villin 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody로, Western blot, IHC, Flow Cytometry에 적합. 인간, 마우스, 랫트 반응성. 항원 친화 크로마토그래피로 정제되었으며, PBS/BSA 버퍼에 보관. 연구용 전용.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 04. 오전 10:07
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA580221 Villin Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원
Thermo Fisher Scientific · Thermo Fisher Scientific Villin Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| Property | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to human Villin (C-terminus, 770–799 aa: EQLVNKPVEELPEGVDPSRKEEHLSIEDFT) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | −20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2747335 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Villin은 위장관 및 신장의 brush border 미세융모의 actin core bundle과 관련된 세포골격 단백질입니다. Ca²⁺ 및 인지질에 의해 조절되는 방식으로 actin과 상호작용할 수 있습니다. Villin은 위장관 및 췌장의 선암종에 대한 매우 특이적인 마커이며, 일부 Merkel 세포종 및 폐, 전립선, 난소, 신장의 선암종에서도 발현됩니다.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음)
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific VWF Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific VRK1 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific VEGFB Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific VCP Polyclonal Antibody568,000원VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.