CacheBy
Atlas Antibodies Anti-TIMM44 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TIMM44 Antibody

상품 한눈에 보기

인간 TIMM44 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. siRNA 노크다운으로 유전적 검증 완료. 고순도 친화 정제 항체로 사람, 생쥐, 랫트 반응성이 확인되었습니다.

카탈로그번호
HPA043052-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA043052-100 Anti-TIMM44 Antibody, translocase of inner mitochondrial membrane 44 homolog (yeast) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043052-25 Anti-TIMM44 Antibody, translocase of inner mitochondrial membrane 44 homolog (yeast) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TIMM44 Antibody

Anti-TIMM44 Antibody

Target: translocase of inner mitochondrial membrane 44 homolog (yeast)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB) – Genetic validation by siRNA knockdown
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human TIMM44.


Alternative Gene Names

  • TIM44

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein translocase of inner mitochondrial membrane 44 homolog (yeast)
Target Gene TIMM44
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence EVLRKKLGELTGTVKESLHEVSKSDLGRKIKEGVEEAAKTAKQSAESVSKGGEKLGRTAAFRALSQGVESVKKEIDDSVLGQTGPYRRPQRLRKRTEFAGDKF

Species Reactivity

  • Human
  • Mouse
  • Rat

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000001058 (87%)
  • Mouse ENSMUSG00000002949 (87%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Application
Genetic Validation
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.