
Atlas Antibodies Anti-TIMM44 Antibody
상품 한눈에 보기
인간 TIMM44 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. siRNA 노크다운으로 유전적 검증 완료. 고순도 친화 정제 항체로 사람, 생쥐, 랫트 반응성이 확인되었습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-TIMM44 Antibody
Target: translocase of inner mitochondrial membrane 44 homolog (yeast)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB) – Genetic validation by siRNA knockdown
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human TIMM44.
Alternative Gene Names
- TIM44
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | translocase of inner mitochondrial membrane 44 homolog (yeast) |
| Target Gene | TIMM44 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | EVLRKKLGELTGTVKESLHEVSKSDLGRKIKEGVEEAAKTAKQSAESVSKGGEKLGRTAAFRALSQGVESVKKEIDDSVLGQTGPYRRPQRLRKRTEFAGDKF |
Species Reactivity
- Human
- Mouse
- Rat
Interspecies Information:
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000001058 (87%)
- Mouse ENSMUSG00000002949 (87%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-TIMM17A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TIMM44 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TIMM44 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TIMM23 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TIMM22 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.