CacheBy
Atlas Antibodies Anti-TIMM23 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TIMM23 Antibody

상품 한눈에 보기

인간 TIMM23 단백질을 인식하는 폴리클로날 항체로, 미토콘드리아 내막 단백질 연구에 적합합니다. 토끼에서 생산된 IgG 항체이며, 고순도 친화 정제 방식으로 제조되었습니다. 인간에 특이적 반응성을 검증하였으며, ICC 등 다양한 응용에 사용 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA031408-100 Anti-TIMM23 Antibody, translocase of inner mitochondrial membrane 23 homolog (yeast) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031408-25 Anti-TIMM23 Antibody, translocase of inner mitochondrial membrane 23 homolog (yeast) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TIMM23 Antibody

Anti-TIMM23 Antibody

Target: translocase of inner mitochondrial membrane 23 homolog (yeast)
Supplier: Atlas Antibodies

면역세포화학 (ICC)

Product Description

Polyclonal antibody against human TIMM23.

Alternative Gene Names

TIM23

Open Datasheet

Target Information

  • Target Protein: translocase of inner mitochondrial membrane 23 homolog (yeast)
  • Target Gene: TIMM23
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    TRGAEDDLNTVAAGTMTGMLYKCTGGLRGIARGGLTGLTLTSLYALYNNWEHMKGSLLQQSL

Verified Species Reactivity

Human

Interspecies Information

Species Ortholog ID Sequence Identity
Mouse ENSMUSG00000069622 98%
Rat ENSRNOG00000019811 97%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.