CacheBy
Atlas Antibodies Anti-TIMM22 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TIMM22 Antibody

상품 한눈에 보기

Human TIMM22 단백질을 인식하는 Rabbit polyclonal 항체로, IHC 및 WB(Recombinant Expression) 검증 완료. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. 인체 미토콘드리아 내막 단백질 연구에 적합.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA045138-100 Anti-TIMM22 Antibody, translocase of inner mitochondrial membrane 22 homolog (yeast) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA045138-25 Anti-TIMM22 Antibody, translocase of inner mitochondrial membrane 22 homolog (yeast) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TIMM22 Antibody

Anti-TIMM22 Antibody

Target: translocase of inner mitochondrial membrane 22 homolog (yeast)
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
  • WB (Western Blot, Recombinant Expression)

Recombinant expression validation in WB using target protein overexpression.


Product Description

Polyclonal Antibody against Human TIMM22


Alternative Gene Names

  • TEX4

Open Datasheet


Target Information

항목 내용
Target Protein translocase of inner mitochondrial membrane 22 homolog (yeast)
Target Gene TIMM22
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence GIDTNVGFDPKDPYRTPTAKEVLKDMGQRGMSYAKNFAIVGAMFSCTECLIESYRGTSDWKNSVISGCITGGAIGFRAGLKA
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000020843 (96%), Rat ENSRNOG00000007988 (95%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Recombinant Expression
Recombinant Expression Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.