CacheBy
Atlas Antibodies Anti-TIMM44 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TIMM44 Antibody

상품 한눈에 보기

Human TIMM44 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. siRNA knockdown을 통한 유전적 검증 완료. Rabbit 유래 IgG, PrEST 항원으로 정제. Human, Mouse, Rat 반응성 확인.

카탈로그번호
HPA073108-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA073108-100 Anti-TIMM44 Antibody, translocase of inner mitochondrial membrane 44 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA073108-25 Anti-TIMM44 Antibody, translocase of inner mitochondrial membrane 44 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TIMM44 Antibody

Anti-TIMM44 Antibody

Target: translocase of inner mitochondrial membrane 44 homolog (yeast)

  • IHC (Immunohistochemistry)
  • WB (Western Blot, Genetic validation by siRNA knockdown)
  • ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human TIMM44

Alternative Gene Names

  • TIM44

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein translocase of inner mitochondrial membrane 44 homolog (yeast)
Target Gene TIMM44
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human, Mouse, Rat
Interspecies Identity Mouse ENSMUSG00000002949 (87%), Rat ENSRNOG00000001058 (87%)

Antigen Sequence

EVLRKKLGELTGTVKESLHEVSKSDLGRKIKEGVEEAAKTAKQSAESVSKGGEKLGRTAAFRALSQGVESVKKEIDDSVLGQTGPYRRPQRLRKRTEFAGDKF

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.
  • Material Safety Data Sheet

제품 이미지

Enhanced Validation
IHC
WB Genetic Validation
Genetic Validation Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.