AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-TIMM17B Antibody
상품 한눈에 보기
인간 TIMM17B 단백질을 인식하는 폴리클로날 항체로, IHC와 WB에 적합합니다. Rabbit 호스트에서 생산되었으며 PrEST 항원으로 친화 정제되었습니다. 인간에 대한 검증된 반응성과 높은 종간 보존성을 제공합니다.
- 카탈로그번호
- HPA029093-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA029093-100 Anti-TIMM17B Antibody, translocase of inner mitochondrial membrane 17 homolog B (yeast) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA029093-25 Anti-TIMM17B Antibody, translocase of inner mitochondrial membrane 17 homolog B (yeast) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TIMM17B Antibody
Anti-TIMM17B Antibody
Target: translocase of inner mitochondrial membrane 17 homolog B (yeast)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against Human TIMM17B.
Alternative Gene Names
DXS9822, JM3
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | translocase of inner mitochondrial membrane 17 homolog B (yeast) |
| Target Gene | TIMM17B |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (92%), Rat (90%) |
Antigen Sequence:
ILLALIEGVGILLTRYTAQQFRNAPPFLEDPSQLPPKDGTPAPGYPSYQQYH
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2)
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.