CacheBy
Atlas Antibodies Anti-TIMM21 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TIMM21 Antibody

상품 한눈에 보기

Human TIMM21 단백질을 인식하는 rabbit polyclonal antibody로, 미토콘드리아 내막 단백질 연구에 적합. IHC 등 다양한 응용에 사용 가능. 고순도 affinity purification 방식으로 제조. Human에 대한 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA010587-100 Anti-TIMM21 Antibody, translocase of inner mitochondrial membrane 21 homolog (yeast) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA010587-25 Anti-TIMM21 Antibody, translocase of inner mitochondrial membrane 21 homolog (yeast) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TIMM21 Antibody

Anti-TIMM21 Antibody

Target: translocase of inner mitochondrial membrane 21 homolog (yeast)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against Human TIMM21.


Alternative Gene Names

  • C18orf55
  • HSPC154
  • TIM21

Open Datasheet


Target Information

항목 내용
Target Protein translocase of inner mitochondrial membrane 21 homolog (yeast)
Target Gene TIMM21
Verified Species Reactivity Human
Interspecies Identity Rat (69%), Mouse (63%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

LRAVQYTEKLHRSSAKRLLLPYIVLNKACLKTEPSLRCGLQYQKKTLRPRCILGVTQKTIWTQGPSPRKAKEDGSKQVSVHRSQRGGTAVPTSQKVKEAGRD

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.