CacheBy
Atlas Antibodies Anti-TIMM21 Antibody
원본

Atlas Antibodies Anti-TIMM21 Antibody

상품 한눈에 보기

인간 TIMM21 단백질을 인식하는 폴리클로날 항체. 미토콘드리아 내막 단백질 수송 복합체 연구에 적합. 토끼 유래 IgG, PrEST 항원으로 친화 정제. 인간에 대한 반응성 검증 완료. PBS/glycerol 버퍼에 나트륨 아지드 보존제 포함.

카탈로그번호
HPA051543-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA051543-100 Anti-TIMM21 Antibody, translocase of inner mitochondrial membrane 21 homolog (yeast) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051543-25 Anti-TIMM21 Antibody, translocase of inner mitochondrial membrane 21 homolog (yeast) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TIMM21 Antibody

Anti-TIMM21 Antibody

Target: translocase of inner mitochondrial membrane 21 homolog (yeast)

  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human TIMM21.

Alternative Gene Names

C18orf55, HSPC154, TIM21

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein translocase of inner mitochondrial membrane 21 homolog (yeast)
Target Gene TIMM21
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000015142 (69%), Mouse ENSMUSG00000024645 (63%)

Antigen Sequence

LRAVQYTEKLHRSSAKRLLLPYIVLNKACLKTEPSLRCGLQYQKKTLRPRCILGVTQKTIWTQGPSPRKAKEDGSKQVSVHRSQRGGTAVPTSQKVKEAGRD

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 성분 설명
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도와 조건은 사용자에 의해 결정되어야 합니다.

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.