
Atlas Antibodies Anti-TCHH Antibody
상품 한눈에 보기
Human TCHH 단백질을 인식하는 폴리클로날 항체로, trichohyalin 연구에 적합합니다. Rabbit에서 생산된 IgG 형태이며, Affinity purification 방식으로 정제되었습니다. IHC 등 다양한 응용에 사용 가능합니다. 40% glycerol 기반 PBS buffer에 보존됩니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-TCHH Antibody
Target Information
- Target Protein: trichohyalin
- Target Gene: TCHH
- Alternative Gene Names: THH
Product Description
Polyclonal antibody against human TCHH, suitable for trichohyalin detection in various research applications.
Recommended Applications
Immunohistochemistry (IHC)
Antigen Information
- Antigen Sequence Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Antigen Sequence:
QEKSRREEQELWQEEEQKRRQERERKLREEHIRRQQKEEQRHRQVGEIKSQEGKGHGRLLEPGTHQFASVPVRSSPLYEY
Verified Species Reactivity
- Human
Interspecies Information
| Species | Ortholog ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000056746 | 63% |
| Mouse | ENSMUSG00000052415 | 63% |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2), containing 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-TCHHL1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TCF7L1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TCHH Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TCFL5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TCFL5 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.