CacheBy
Atlas Antibodies Anti-TCHH Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TCHH Antibody

상품 한눈에 보기

Human TCHH 단백질을 인식하는 폴리클로날 항체로, trichohyalin 연구에 적합합니다. Rabbit에서 생산된 IgG 형태이며, Affinity purification 방식으로 정제되었습니다. IHC 등 다양한 응용에 사용 가능합니다. 40% glycerol 기반 PBS buffer에 보존됩니다.

카탈로그번호
HPA028375-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA028375-100 Anti-TCHH Antibody, trichohyalin 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028375-25 Anti-TCHH Antibody, trichohyalin 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TCHH Antibody

Anti-TCHH Antibody

Target Information

  • Target Protein: trichohyalin
  • Target Gene: TCHH
  • Alternative Gene Names: THH

Product Description

Polyclonal antibody against human TCHH, suitable for trichohyalin detection in various research applications.

Immunohistochemistry (IHC)

Antigen Information

  • Antigen Sequence Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Antigen Sequence:
    QEKSRREEQELWQEEEQKRRQERERKLREEHIRRQQKEEQRHRQVGEIKSQEGKGHGRLLEPGTHQFASVPVRSSPLYEY

Verified Species Reactivity

  • Human

Interspecies Information

Species Ortholog ID Sequence Identity
Rat ENSRNOG00000056746 63%
Mouse ENSMUSG00000052415 63%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2), containing 0.02% sodium azide as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.