CacheBy
Atlas Antibodies Anti-TCFL5 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TCFL5 Antibody

상품 한눈에 보기

인간 TCFL5 단백질을 인식하는 고품질 폴리클로날 항체. IHC 및 ICC 응용에 적합하며 RNA-seq 데이터와 비교한 정교한 Orthogonal 검증 제공. Rabbit 유래 IgG 항체로 PrEST 항원 기반 친화 정제.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA055223-100 Anti-TCFL5 Antibody, transcription factor-like 5 (basic helix-loop-helix) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA055223-25 Anti-TCFL5 Antibody, transcription factor-like 5 (basic helix-loop-helix) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TCFL5 Antibody

Anti-TCFL5 Antibody

transcription factor-like 5 (basic helix-loop-helix)

  • Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human TCFL5

Alternative Gene Names

bHLHe82, CHA, E2BP-1, Figlb

Open Datasheet

Target Information

항목 내용
Target Protein transcription factor-like 5 (basic helix-loop-helix)
Target Gene TCFL5
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000061199 (91%), Mouse ENSMUSG00000038932 (88%)

Antigen Sequence:

KRNRSRMRQLDTNVERRALGEIQNVGEGATATQGAWQSSESSQANLGEQAQSGPQGGRSQRRERHNRMERDRRRRIRI

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.