Atlas Antibodies Anti-TCFL5 Antibody

상품 한눈에 보기

인간 TCFL5 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 등 다양한 응용에 적합합니다. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. Rabbit IgG 형식이며, Human 반응성이 검증되었습니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA076419-100 Anti-TCFL5 Antibody, transcription factor like 5 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA076419-25 Anti-TCFL5 Antibody, transcription factor like 5 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

transcription factor-like 5 (basic helix-loop-helix)

IHC Orthogonal Validation
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
ICC (Immunocytochemistry)

Polyclonal Antibody against Human TCFL5

bHLHe82, CHA, E2BP-1, Figlb

항목	내용
Target Protein	transcription factor-like 5 (basic helix-loop-helix)
Target Gene	TCFL5
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	KRNRSRMRQLDTNVERRALGEIQNVGEGATATQGAWQSSESSQANLGEQAQSGPQGGRSQRRERHNRMERDRRRRIRI
Verified Species Reactivity	Human
Interspecies Identity	Rat (91%), Mouse (88%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.