
Atlas Antibodies Anti-TCHHL1 Antibody
상품 한눈에 보기
Human TCHHL1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. Human에 검증된 반응성을 보유합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-TCHHL1 Antibody
Target Protein: trichohyalin-like 1
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Independent antibody validation)
- ICC
Validation Note:
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human TCHHL1
Alternative Gene Names
S100A17, THHL1
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
KHSNIQEPPLQREDEPSSQHADLPEQAAARSPSQTQKSTDSKDVCRMFDTQEPGKDADQTPAKTKNLGEPEDYGRTSETQEKECETKDLPVQYGSRN
Verified Species Reactivity
- Human
Interspecies Information
| Species | Ortholog ID | Identity |
|---|---|---|
| Mouse | ENSMUSG00000027908 | 39% |
| Rat | ENSRNOG00000009610 | 38% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-TCHP Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TCHHL1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TCHHL1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TCF7L1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TCHH Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.