
Atlas Antibodies Anti-TBRG1 Antibody
Human TBRG1 단백질을 인식하는 토끼 폴리클로날 항체로, 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. 인간 시료에 검증되었으며, 마우스 및 랫과 77% 상동성을 가집니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-TBRG1 Antibody
Target: Transforming growth factor beta regulator 1 (TBRG1)
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against human TBRG1, produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.
Alternative Gene Names
FLJ14621, NIAM, TB-5
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Transforming growth factor beta regulator 1 |
| Target Gene | TBRG1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000011114 (77%), Rat ENSRNOG00000033891 (77%) |
Antigen Sequence
YQWVKFDVCKPGDGQLPEGLPENDAAMSFEAFQRQIFDEDQNDPLLPGSLDLPELQPAAFVSSYQPMYLTHEPLVDTHLQHLKSPSQGSPI
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen |
Buffer
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Recommended Applications
Immunocytochemistry (ICC)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-TBRG4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TBRG1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TBRG1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TBX10 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TBRG4 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|