CacheBy
Atlas Antibodies Anti-TBRG1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TBRG1 Antibody

상품 한눈에 보기

Human TBRG1 단백질을 인식하는 토끼 폴리클로날 항체로, 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. 인간 시료에 검증되었으며, 마우스 및 랫과 77% 상동성을 가집니다.

카탈로그번호
HPA055645-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA055645-100 Anti-TBRG1 Antibody, transforming growth factor beta regulator 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA055645-25 Anti-TBRG1 Antibody, transforming growth factor beta regulator 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TBRG1 Antibody

Anti-TBRG1 Antibody

Target: Transforming growth factor beta regulator 1 (TBRG1)
Supplier: Atlas Antibodies


Product Description

Polyclonal antibody against human TBRG1, produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.


Alternative Gene Names

FLJ14621, NIAM, TB-5


Target Information

항목 내용
Target Protein Transforming growth factor beta regulator 1
Target Gene TBRG1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000011114 (77%), Rat ENSRNOG00000033891 (77%)

Antigen Sequence

YQWVKFDVCKPGDGQLPEGLPENDAAMSFEAFQRQIFDEDQNDPLLPGSLDLPELQPAAFVSSYQPMYLTHEPLVDTHLQHLKSPSQGSPI


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen

Buffer

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Immunocytochemistry (ICC)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet (PDF)


제품 이미지

Recommended Applications - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.