CacheBy
Atlas Antibodies Anti-TBRG1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TBRG1 Antibody

상품 한눈에 보기

Human TBRG1 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. ICC 등 다양한 응용에 적합하며, PrEST 항원으로 친화 정제됨. Human에 반응하며 Mouse, Rat과 77% 서열 유사성 보유. 안정한 PBS/glycerol buffer에 보존됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA068022-100 Anti-TBRG1 Antibody, transforming growth factor beta regulator 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA068022-25 Anti-TBRG1 Antibody, transforming growth factor beta regulator 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TBRG1 Antibody

Anti-TBRG1 Antibody

Target Information

  • Target Protein: Transforming growth factor beta regulator 1
  • Target Gene: TBRG1
  • Alternative Gene Names: FLJ14621, NIAM, TB-5
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human TBRG1.

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen
  • Antigen Sequence:
    YQWVKFDVCKPGDGQLPEGLPENDAAMSFEAFQRQIFDEDQNDPLLPGSLDLPELQPAAFVSSYQPMYLTHEPLVDTHLQHLKSPSQGSPI

Species Reactivity

  • Verified Species: Human
  • Interspecies Information:
    Highest antigen sequence identity to the following orthologs:
    • Mouse (ENSMUSG00000011114): 77%
    • Rat (ENSRNOG00000033891): 77%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative.
Storage Note Gently mix before use. Optimal concentrations and conditions should be determined by the user.

Reference Documents

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.