
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-TBRG1 Antibody
상품 한눈에 보기
Human TBRG1 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. ICC 등 다양한 응용에 적합하며, PrEST 항원으로 친화 정제됨. Human에 반응하며 Mouse, Rat과 77% 서열 유사성 보유. 안정한 PBS/glycerol buffer에 보존됨.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA068022-100 Anti-TBRG1 Antibody, transforming growth factor beta regulator 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA068022-25 Anti-TBRG1 Antibody, transforming growth factor beta regulator 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TBRG1 Antibody
Anti-TBRG1 Antibody
Target Information
- Target Protein: Transforming growth factor beta regulator 1
- Target Gene: TBRG1
- Alternative Gene Names: FLJ14621, NIAM, TB-5
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human TBRG1.
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen
- Antigen Sequence:
YQWVKFDVCKPGDGQLPEGLPENDAAMSFEAFQRQIFDEDQNDPLLPGSLDLPELQPAAFVSSYQPMYLTHEPLVDTHLQHLKSPSQGSPI
Species Reactivity
- Verified Species: Human
- Interspecies Information:
Highest antigen sequence identity to the following orthologs:- Mouse (ENSMUSG00000011114): 77%
- Rat (ENSRNOG00000033891): 77%
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative. |
| Storage Note | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
Reference Documents
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



