Atlas Antibodies Anti-TBRG1 Antibody

상품 한눈에 보기

Human TBRG1 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. ICC 등 다양한 응용에 적합하며, PrEST 항원으로 친화 정제됨. Human에 반응하며 Mouse, Rat과 77% 서열 유사성 보유. 안정한 PBS/glycerol buffer에 보존됨.

카탈로그번호: HPA068022-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA068022-100 Anti-TBRG1 Antibody, transforming growth factor beta regulator 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA068022-25 Anti-TBRG1 Antibody, transforming growth factor beta regulator 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-TBRG1 Antibody

Anti-TBRG1 Antibody

Target Information

Target Protein: Transforming growth factor beta regulator 1
Target Gene: TBRG1
Alternative Gene Names: FLJ14621, NIAM, TB-5

Recommended Applications

Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human TBRG1.

Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen
Antigen Sequence:
YQWVKFDVCKPGDGQLPEGLPENDAAMSFEAFQRQIFDEDQNDPLLPGSLDLPELQPAAFVSSYQPMYLTHEPLVDTHLQHLKSPSQGSPI

Species Reactivity

Verified Species: Human
Interspecies Information:
Highest antigen sequence identity to the following orthologs:
- Mouse (ENSMUSG00000011114): 77%
- Rat (ENSRNOG00000033891): 77%

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative.
Storage Note	Gently mix before use. Optimal concentrations and conditions should be determined by the user.