CacheBy
Atlas Antibodies Anti-TBRG4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TBRG4 Antibody

상품 한눈에 보기

Human TBRG4 단백질에 대한 고특이성 폴리클로날 항체로, Rabbit 호스트에서 생산됨. IHC, WB, ICC 등 다양한 응용에 적합하며 siRNA knockdown을 통한 유전적 검증 완료. PrEST 항원을 이용한 친화 정제 및 높은 재현성 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA050430-100 Anti-TBRG4 Antibody, transforming growth factor beta regulator 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA050430-25 Anti-TBRG4 Antibody, transforming growth factor beta regulator 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TBRG4 Antibody

Anti-TBRG4 Antibody

Transforming Growth Factor Beta Regulator 4


  • Immunohistochemistry (IHC)
  • Western Blot (WB) — Genetic validation by siRNA knockdown
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human TBRG4


Alternative Gene Names

  • Cpr2
  • FASTKD4
  • H_TD2522F11.8
  • KIAA0948

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Transforming Growth Factor Beta Regulator 4
Target Gene TBRG4
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence HLVKRCTCLLREAARQAPAMAPVGRLRLAWVAHKTLTSSATSPISHLPGSLMEPVEKERASTPYIEKQVDHLIKKATRPEELLELLGGSHDLDSNQAAMVLIRLSHLLSEKP
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000052477 (68%), Mouse ENSMUSG00000000384 (65%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB
GENETIC Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.