CacheBy
Atlas Antibodies Anti-TBRG4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TBRG4 Antibody

상품 한눈에 보기

Human TBRG4 단백질을 표적으로 하는 폴리클로날 토끼 항체. IHC, WB, ICC 등 다양한 응용에 적합하며 siRNA 노크다운을 통한 유전적 검증 완료. 프레스티 항원으로 친화 정제되어 높은 특이성과 재현성을 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA020582-100 Anti-TBRG4 Antibody, transforming growth factor beta regulator 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA020582-25 Anti-TBRG4 Antibody, transforming growth factor beta regulator 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TBRG4 Antibody

Anti-TBRG4 Antibody

Transforming Growth Factor Beta Regulator 4 (TBRG4)

  • Immunohistochemistry (IHC)
  • Western Blot (WB) – Genetic validation by siRNA knockdown
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human TBRG4.

Alternative Gene Names

Cpr2, FASTKD4, H_TD2522F11.8, KIAA0948

Open Datasheet

Target Information

항목 내용
Target Protein Transforming growth factor beta regulator 4
Target Gene TBRG4
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000052477 (68%), Mouse ENSMUSG00000000384 (65%)

Antigen Sequence

HLVKRCTCLLREAARQAPAMAPVGRLRLAWVAHKTLTSSATSPISHLPGSLMEPVEKERASTPYIEKQVDHLIKKATRPEELLELLGGSHDLDSNQAAMVLIRLSHLLSEKP

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Genetic Validation
Genetic Validation Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.