CacheBy
Atlas Antibodies Anti-TBRG4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TBRG4 Antibody

상품 한눈에 보기

Human TBRG4 단백질을 표적으로 하는 폴리클로날 토끼 항체. IHC, WB, ICC 등 다양한 응용에 적합하며 siRNA 노크다운을 통한 유전적 검증 완료. 프레스티 항원으로 친화 정제되어 높은 특이성과 재현성을 제공.

카탈로그번호
HPA020582-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA020582-100 Anti-TBRG4 Antibody, transforming growth factor beta regulator 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA020582-25 Anti-TBRG4 Antibody, transforming growth factor beta regulator 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TBRG4 Antibody

Anti-TBRG4 Antibody

Transforming Growth Factor Beta Regulator 4 (TBRG4)

  • Immunohistochemistry (IHC)
  • Western Blot (WB) – Genetic validation by siRNA knockdown
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human TBRG4.

Alternative Gene Names

Cpr2, FASTKD4, H_TD2522F11.8, KIAA0948

Open Datasheet

Target Information

항목 내용
Target Protein Transforming growth factor beta regulator 4
Target Gene TBRG4
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000052477 (68%), Mouse ENSMUSG00000000384 (65%)

Antigen Sequence

HLVKRCTCLLREAARQAPAMAPVGRLRLAWVAHKTLTSSATSPISHLPGSLMEPVEKERASTPYIEKQVDHLIKKATRPEELLELLGGSHDLDSNQAAMVLIRLSHLLSEKP

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Genetic Validation
Genetic Validation Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.