Thermo Fisher Scientific IFNAR1 Polyclonal Antibody
인간 IFNAR1 단백질을 인식하는 Rabbit Polyclonal 항체. Western blot에 적합하며, 항원 친화 크로마토그래피로 정제됨. 동결건조 형태로 제공되며, 재구성 시 500 µg/mL 농도. PBS 및 트레할로스 완충액에 보관, -20°C 저장.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human IFNAR1 (263–306aa: HAFLKRNPGNHLYKWKQIPDCENVKTTQCVFPQNVFQKGIYLLR) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | No preservative |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2746557 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Interferons are widely used therapeutic agents due to their antitumor and antiviral effects, and their modulatory effects on the immune system (Biron, 2001; Kirkwood, 2002). These cytokines exert their effects by binding to the Type I Interferon Receptor (IFNAR1). Downregulation of this receptor plays a key role in determining the magnitude and duration of cytokine signaling, which is influenced by phosphorylation of Serine 535 and 539 in IFNAR1 (Kumar et al., 2003).
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific IGF1R (CD221) Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific IFNGR1 (CD119) Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific IFNAR1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific IDO2 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific IFITM1 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|