
Thermo Fisher Scientific IFNAR1 Polyclonal Antibody
인간 IFNAR1 단백질을 인식하는 Rabbit Polyclonal 항체. Western blot에 적합하며, 항원 친화 크로마토그래피로 정제됨. 동결건조 형태로 제공되며, 재구성 시 500 µg/mL 농도. PBS 및 트레할로스 완충액에 보관, -20°C 저장.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific IFNAR1 Polyclonal Antibody
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human IFNAR1 (263–306aa: HAFLKRNPGNHLYKWKQIPDCENVKTTQCVFPQNVFQKGIYLLR) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | No preservative |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2746557 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Interferons are widely used therapeutic agents due to their antitumor and antiviral effects, and their modulatory effects on the immune system (Biron, 2001; Kirkwood, 2002). These cytokines exert their effects by binding to the Type I Interferon Receptor (IFNAR1). Downregulation of this receptor plays a key role in determining the magnitude and duration of cytokine signaling, which is influenced by phosphorylation of Serine 535 and 539 in IFNAR1 (Kumar et al., 2003).
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.
