Thermo Fisher Scientific IFNGR1 (CD119) Polyclonal Antibody
IFNGR1(CD119) 단백질을 표적하는 Rabbit Polyclonal 항체로, WB, IHC(F), ICC/IF, Flow Cytometry에 사용 가능. 인간 시료 반응성. 항원 친화 크로마토그래피로 정제되었으며, 동결건조 상태로 제공. 연구용으로만 사용.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific IFNGR1 (CD119) Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Frozen) (IHC (F)) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 0.5–1 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| Item | Description |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human IFNGR1 (443–484aa QELITVIKAPTSFGYDKPHVLVDLLVDDSGKESLIGYRPTED) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2746558 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The IFNGR1 gene encodes the ligand-binding chain (alpha) of the gamma interferon receptor. The human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. Genetic variations in IFNGR1 are associated with susceptibility to Helicobacter pylori infection. Defects in IFNGR1 can cause Mendelian susceptibility to mycobacterial disease, also known as familial disseminated atypical mycobacterial infection.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.