
Atlas Antibodies Anti-SUCLA2 Antibody
상품 한눈에 보기
Human SUCLA2 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에서 독립 항체 검증 완료. Rabbit 유래 IgG로 PrEST 항원 친화정제 방식으로 제조. Human 및 Mouse 반응성 검증 완료.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SUCLA2 Antibody
Target: succinate-CoA ligase, ADP-forming, beta subunit (SUCLA2)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Independent antibody validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
- WB (Independent antibody validation): Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody against Human SUCLA2.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | succinate-CoA ligase, ADP-forming, beta subunit |
| Target Gene | SUCLA2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | FGGIMRCDVIAQGIVMAVKDLEIKIPVVVRLQGTRVDDAKALIADSGLKILACDDLDEAARMVVKLSEIVTLAKQAHVDVKFQLP |
Species Reactivity
| Verified Species | Human, Mouse |
|---|---|
| Ortholog Identity | Mouse ENSMUSG00000022110 (96%) Rat ENSRNOG00000017481 (95%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SUDS3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SUCO Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SUCLA2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SUCLG1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SUCLA2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.