CacheBy
Atlas Antibodies Anti-SUDS3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SUDS3 Antibody

상품 한눈에 보기

Human SUDS3 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 Western blot에 적합합니다. PrEST 항원으로 친화 정제되었으며, 높은 종간 반응성(인간, 마우스, 랫트 100%)을 보입니다. 안정적 PBS/glycerol buffer에 보존되어 실험 재현성이 우수합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA041972-100 Anti-SUDS3 Antibody, suppressor of defective silencing 3 homolog (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041972-25 Anti-SUDS3 Antibody, suppressor of defective silencing 3 homolog (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SUDS3 Antibody

Anti-SUDS3 Antibody

Target: suppressor of defective silencing 3 homolog (S. cerevisiae)

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against Human SUDS3.

Alternative Gene Names

FLJ00052, SAP45, SDS3

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein suppressor of defective silencing 3 homolog (S. cerevisiae)
Target Gene SUDS3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000066900 (100%), Rat ENSRNOG00000001139 (100%)

Antigen Sequence:
KAAVKEFEDKKVELKENLIAELEEKKKMIENEKLTMELTGDSMEVKPIMTRKLRRRPNDPVPIPDKRRKPAPAQLNYLLTDEQIMEDLRTLNKLKSPKRPA

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.