Atlas Antibodies Anti-SUCLG1 Antibody

상품 한눈에 보기

Human SUCLG1 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공. Human, Mouse, Rat 반응성 검증 완료.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA036683-100 Anti-SUCLG1 Antibody, succinate-CoA ligase, alpha subunit 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA036683-25 Anti-SUCLG1 Antibody, succinate-CoA ligase, alpha subunit 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: succinate-CoA ligase, alpha subunit
Product Type: Polyclonal Antibody against Human SUCLG1

IHC (Independent Validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
WB (Independent Validation): Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
ICC: Suitable for immunocytochemistry applications.

Polyclonal antibody generated in rabbit against Human SUCLG1.
Affinity purified using the PrEST antigen as affinity ligand.

항목	내용
Target Protein	succinate-CoA ligase, alpha subunit
Target Gene	SUCLG1
Antigen Sequence	LPQNGIRHCSYTASRQHLYVDKNTKIICQGFTGKQGTFHSQQALEYGTKLVGGTTPGKGGQTHLGLPVFNTVKEAKEQTGA
Verified Species Reactivity	Human, Mouse, Rat
Interspecies Identity	Mouse ENSMUSG00000052738 (91%), Rat ENSRNOG00000005587 (88%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen
Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.
MSDS	Material Safety Data Sheet