
Atlas Antibodies Anti-SUCLG1 Antibody
상품 한눈에 보기
Human SUCLG1 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공. Human, Mouse, Rat 반응성 검증 완료.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SUCLG1 Antibody
Target Protein: succinate-CoA ligase, alpha subunit
Product Type: Polyclonal Antibody against Human SUCLG1
Recommended Applications
- IHC (Independent Validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
- WB (Independent Validation): Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
- ICC: Suitable for immunocytochemistry applications.
Product Description
Polyclonal antibody generated in rabbit against Human SUCLG1.
Affinity purified using the PrEST antigen as affinity ligand.
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | succinate-CoA ligase, alpha subunit |
| Target Gene | SUCLG1 |
| Antigen Sequence | LPQNGIRHCSYTASRQHLYVDKNTKIICQGFTGKQGTFHSQQALEYGTKLVGGTTPGKGGQTHLGLPVFNTVKEAKEQTGA |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Identity | Mouse ENSMUSG00000052738 (91%), Rat ENSRNOG00000005587 (88%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen |
| Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
| MSDS | Material Safety Data Sheet |
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SUCO Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SUCLA2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SUCLG1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SUCLA2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SUB1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.