Atlas Antibodies Anti-SUCLA2 Antibody

상품 한눈에 보기

SUCLA2 단백질을 인식하는 토끼 폴리클로날 항체로, 인간 및 생쥐 시료에서 IHC와 WB 검증에 적합. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 서열 유사성을 가짐. 40% 글리세롤 기반 PBS 버퍼에 보존제 포함.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA039435-100 Anti-SUCLA2 Antibody, succinate-CoA ligase, ADP-forming, beta subunit 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA039435-25 Anti-SUCLA2 Antibody, succinate-CoA ligase, ADP-forming, beta subunit 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: succinate-CoA ligase, ADP-forming, beta subunit
Supplier: Atlas Antibodies

IHC (Immunohistochemistry)
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
WB (Western Blot)
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Polyclonal antibody against human SUCLA2.

항목	내용
Target Protein	succinate-CoA ligase, ADP-forming, beta subunit
Target Gene	SUCLA2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	FGGIMRCDVIAQGIVMAVKDLEIKIPVVVRLQGTRVDDAKALIADSGLKILACDDLDEAARMVVKLSEIVTLAKQAHVDVKFQLP
Verified Species Reactivity	Human, Mouse
Interspecies Information	Mouse ENSMUSG00000022110 (96%), Rat ENSRNOG00000017481 (95%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative (Material Safety Data Sheet)