Atlas Antibodies Anti-SUCLA2 Antibody
상품 한눈에 보기
SUCLA2 단백질을 인식하는 토끼 폴리클로날 항체로, 인간 및 생쥐 시료에서 IHC와 WB 검증에 적합. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 서열 유사성을 가짐. 40% 글리세롤 기반 PBS 버퍼에 보존제 포함.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SUCLA2 Antibody
Target: succinate-CoA ligase, ADP-forming, beta subunit
Supplier: Atlas Antibodies
Recommended Applications
IHC (Immunohistochemistry)
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.WB (Western Blot)
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody against human SUCLA2.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | succinate-CoA ligase, ADP-forming, beta subunit |
| Target Gene | SUCLA2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | FGGIMRCDVIAQGIVMAVKDLEIKIPVVVRLQGTRVDDAKALIADSGLKILACDDLDEAARMVVKLSEIVTLAKQAHVDVKFQLP |
| Verified Species Reactivity | Human, Mouse |
| Interspecies Information | Mouse ENSMUSG00000022110 (96%), Rat ENSRNOG00000017481 (95%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative (Material Safety Data Sheet) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Atlas Antibodies
Atlas Antibodies Anti-SUCLA2 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-SUCLG1 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-SUCLA2 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-SUB1 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-SUCLG1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.