CacheBy
Atlas Antibodies Anti-STIP1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-STIP1 Antibody

상품 한눈에 보기

인간 STIP1 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. 정제된 PrEST 항원을 사용하여 높은 특이성과 재현성을 보장. RNA-seq 및 독립 항체 비교를 통한 검증 완료. 40% 글리세롤 기반 안정화 버퍼 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA039291-100 Anti-STIP1 Antibody, stress-induced phosphoprotein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039291-25 Anti-STIP1 Antibody, stress-induced phosphoprotein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-STIP1 Antibody

Anti-STIP1 Antibody

Target: stress-induced phosphoprotein 1 (STIP1)


  • IHC (Orthogonal validation): Protein expression verified by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Independent antibody validation): Protein expression validated by comparing independent antibodies targeting different epitopes of the protein.
  • ICC: Suitable for immunocytochemistry applications.

Product Description

Polyclonal antibody against human STIP1.


Alternative Gene Names

HOP, STI1

Open Datasheet (PDF)


Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    EAKRTYEEGLKHEANNPQLKEGLQNMEARLAERKFMNPFNMPNLYQKLESDPRTRTLLSDPTYRELIEQLRNKPSDLGTKLQDPRIMTTLSVLLGVDLGSMD

Species Reactivity

  • Verified Species: Human
  • Interspecies Identity:
    • Rat ENSRNOG00000021164 (95%)
    • Mouse ENSMUSG00000024966 (94%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
WB Independent
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.