
Atlas Antibodies Anti-STIP1 Antibody
상품 한눈에 보기
인간 STIP1 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. 정제된 PrEST 항원을 사용하여 높은 특이성과 재현성을 보장. RNA-seq 및 독립 항체 비교를 통한 검증 완료. 40% 글리세롤 기반 안정화 버퍼 제공.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-STIP1 Antibody
Target: stress-induced phosphoprotein 1 (STIP1)
Recommended Applications
- IHC (Orthogonal validation): Protein expression verified by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- WB (Independent antibody validation): Protein expression validated by comparing independent antibodies targeting different epitopes of the protein.
- ICC: Suitable for immunocytochemistry applications.
Product Description
Polyclonal antibody against human STIP1.
Alternative Gene Names
HOP, STI1
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
EAKRTYEEGLKHEANNPQLKEGLQNMEARLAERKFMNPFNMPNLYQKLESDPRTRTLLSDPTYRELIEQLRNKPSDLGTKLQDPRIMTTLSVLLGVDLGSMD
Species Reactivity
- Verified Species: Human
- Interspecies Identity:
- Rat ENSRNOG00000021164 (95%)
- Mouse ENSMUSG00000024966 (94%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-STK10 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-STEAP4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-STIP1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-STIM2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-STIM1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.