CacheBy
Atlas Antibodies Anti-STK10 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-STK10 Antibody

상품 한눈에 보기

Human STK10 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에서 RNA-seq 데이터 기반 Orthogonal Validation 완료. Affinity 정제 방식으로 높은 특이성과 재현성을 제공하며, 다양한 조직 및 세포주 분석에 적합.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA015083-100 Anti-STK10 Antibody, serine/threonine kinase 10 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA015083-25 Anti-STK10 Antibody, serine/threonine kinase 10 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-STK10 Antibody

Anti-STK10 Antibody

Target: serine/threonine kinase 10 (STK10)
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
    Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Western Blot)
    Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Product Description

Polyclonal Antibody against Human STK10.

Alternative Gene Names

  • LOK
  • PRO2729

Open Datasheet


Specifications

항목 내용
Target Protein serine/threonine kinase 10
Target Gene STK10
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence TLENHTQNSSEVSPPSLNADKPLEESPSTPLAPSQSQDSVNEPCSQPSGDRSLQTTSPPVVAPGNENGLAVPVPLRKSRPVSMDARIQVAQEKQVAEQGG
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000004217 (60%), Mouse ENSMUSG00000020272 (59%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
WB Orthogonal Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.