CacheBy
Atlas Antibodies Anti-STIM1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-STIM1 Antibody

상품 한눈에 보기

Human STIM1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. 독립적 및 직교적 검증을 통해 높은 특이성과 신뢰성을 제공합니다. Affinity purification으로 정제된 고품질 연구용 항체입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA012123-100 Anti-STIM1 Antibody, stromal interaction molecule 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA012123-25 Anti-STIM1 Antibody, stromal interaction molecule 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-STIM1 Antibody

Anti-STIM1 Antibody

Target: Stromal interaction molecule 1 (STIM1)
Host: Rabbit
Clonality: Polyclonal
Supplier: Atlas Antibodies


  • IHC (Independent validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Orthogonal validation): Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
  • ICC

Product Description

Polyclonal Antibody against Human STIM1.


Alternative Gene Names

D11S4896E, GOK


Target Information

항목 내용
Target Protein Stromal interaction molecule 1
Target Gene STIM1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000030987 (98%), Rat ENSRNOG00000020425 (97%)

Antigen Sequence:

TAKQALSEVTAALRERLHRWQQIEILCGFQIVNNPGIHSLVAALNIDPSWMGSTRPNPAHFIMTDDVDDMDEEIVSPLSMQSPSLQSSVRQRLTEPQHGLGSQRDLTHSDSESSLHMSDRQRVAPKPPQMSRAADEALNAMTSNGSH

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet


제품 이미지

Enhanced Validation
IHC Independent Validation
Tooltip Independent
WB Orthogonal Validation
Tooltip Orthogonal
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.