
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-STIM2 Antibody
상품 한눈에 보기
Human STIM2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 고순도 IgG 형태로 제공됩니다. 인간에 반응하며 마우스 및 랫과 높은 상동성을 가집니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA057511-100 Anti-STIM2 Antibody, stromal interaction molecule 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA057511-25 Anti-STIM2 Antibody, stromal interaction molecule 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-STIM2 Antibody
Anti-STIM2 Antibody
Target: stromal interaction molecule 2 (STIM2)
Host: Rabbit
Clonality: Polyclonal
Applications: IHC, WB
Product Description
Polyclonal antibody against human STIM2 protein.
Affinity purified using the recombinant PrEST antigen as affinity ligand.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | stromal interaction molecule 2 |
| Target Gene | STIM2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | WGSPDCVGLTETKSMIFSPASKVYNGILEKSCSMNQLSSGIPVPKPRHTSCSSAGNDSKPVQEAPSVARISSIP |
Species Reactivity
| 종 | 유전자 ID | 항원 서열 상동성 |
|---|---|---|
| Human | - | 100% |
| Mouse | ENSMUSG00000039156 | 88% |
| Rat | ENSRNOG00000002956 | 85% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen |
| Storage & Handling | Gently mix before use. Determine optimal concentration and conditions for each application. |
Material Safety Data Sheet (MSDS)
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



