Atlas Antibodies Anti-STIM2 Antibody

상품 한눈에 보기

Human STIM2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 고순도 IgG 형태로 제공됩니다. 인간에 반응하며 마우스 및 랫과 높은 상동성을 가집니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA057511-100 Anti-STIM2 Antibody, stromal interaction molecule 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA057511-25 Anti-STIM2 Antibody, stromal interaction molecule 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: stromal interaction molecule 2 (STIM2)
Host: Rabbit
Clonality: Polyclonal
Applications: IHC, WB

Polyclonal antibody against human STIM2 protein.
Affinity purified using the recombinant PrEST antigen as affinity ligand.

항목	내용
Target Protein	stromal interaction molecule 2
Target Gene	STIM2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	WGSPDCVGLTETKSMIFSPASKVYNGILEKSCSMNQLSSGIPVPKPRHTSCSSAGNDSKPVQEAPSVARISSIP

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen
Storage & Handling	Gently mix before use. Determine optimal concentration and conditions for each application.