CacheBy
Atlas Antibodies Anti-STIL Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-STIL Antibody

상품 한눈에 보기

인간 STIL 단백질을 표적으로 하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 타입입니다. ICC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제되었습니다. 인간에 대한 반응성이 검증되어 있으며, 40% 글리세롤 PBS 버퍼에 보존됩니다.

카탈로그번호
HPA046543-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA046543-100 Anti-STIL Antibody, SCL/TAL1 interrupting locus 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA046543-25 Anti-STIL Antibody, SCL/TAL1 interrupting locus 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-STIL Antibody

Anti-STIL Antibody

Target Information

  • Target Protein: SCL/TAL1 interrupting locus
  • Target Gene: STIL
  • Alternative Gene Names: MCPH7, SIL

이미지 내 텍스트: ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human STIL

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
RLLEAQSLMPCSPKTTAVEDTVQAGRQMELVSVEAQSSPGLHMRKGVSIAVSTGASLFWNAAGEDQEPDSQMKQDDTKI

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity (%)
Mouse ENSMUSG00000028718 85%
Rat ENSRNOG00000057760 81%

Antibody Details

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet
Open Datasheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.