
Atlas Antibodies Anti-STIL Antibody
상품 한눈에 보기
인간 STIL 단백질을 표적으로 하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 타입입니다. ICC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제되었습니다. 인간에 대한 반응성이 검증되어 있으며, 40% 글리세롤 PBS 버퍼에 보존됩니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-STIL Antibody
Target Information
- Target Protein: SCL/TAL1 interrupting locus
- Target Gene: STIL
- Alternative Gene Names: MCPH7, SIL
Recommended Applications
이미지 내 텍스트: ICC (Immunocytochemistry)
Product Description
Polyclonal Antibody against Human STIL
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:RLLEAQSLMPCSPKTTAVEDTVQAGRQMELVSVEAQSSPGLHMRKGVSIAVSTGASLFWNAAGEDQEPDSQMKQDDTKI
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
| Species | Gene ID | Identity (%) |
|---|---|---|
| Mouse | ENSMUSG00000028718 | 85% |
| Rat | ENSRNOG00000057760 | 81% |
Antibody Details
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet
Open Datasheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-STIM1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-STIM2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-STIL Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-STIM1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-STEAP4 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.