Thermo Fisher Scientific SERCA3 ATPase Polyclonal Antibody
SERCA3 ATPase 단백질을 인식하는 토끼 폴리클로날 항체. Western blot 및 IHC(P)에서 검증됨. 인간, 마우스, 랫트 반응성. 항원 친화 크로마토그래피로 정제된 동결건조 제형. 연구용으로만 사용 가능.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human ATP2A3 (1–30aa, MEAAHLLPAADVLRHFSVTAEGGLSPAQVT) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage conditions | -20°C |
| Shipping conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2745954 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
ATP-dependent calcium pumps help maintain low cytoplasmic calcium concentrations. These pumps, located in intracellular organelles, belong to the sarcoplasmic or endoplasmic reticulum calcium ATPases (SERCA) family.
The SERCA2 gene produces two isoforms: SERCA2a (muscle-specific, expressed in skeletal, cardiac, and smooth muscle) and SERCA2b (expressed in all cell types).
SERCA3 co-expresses with SERCA2b in platelets, mast cells, lymphoid cells, and epithelial cells, and is known as the non-muscle form of SERCA.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific ATP5H Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Ataxin 1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific SERCA3 ATPase Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific ATP4B Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific SERCA2 ATPase Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|