CacheBy
Thermo Fisher Scientific SERCA3 ATPase Polyclonal Antibody
원본

Thermo Fisher Scientific SERCA3 ATPase Polyclonal Antibody

상품 한눈에 보기

SERCA3 ATPase 단백질을 인식하는 토끼 폴리클로날 항체. Western blot 및 IHC(P)에서 검증됨. 인간, 마우스, 랫트 반응성. 항원 친화 크로마토그래피로 정제된 동결건조 제형. 연구용으로만 사용 가능.

판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 03. 오전 06:12
Thermo Fisher Scientific PA578838 SERCA3 ATPase Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원

Thermo Fisher Scientific · Thermo Fisher Scientific SERCA3 ATPase Polyclonal Antibody

Applications and Tested Dilution

Application Tested Dilution
Western Blot (WB) 0.1–0.5 µg/mL
Immunohistochemistry (Paraffin) (IHC (P)) 0.5–1 µg/mL

Product Specifications

항목 내용
Species Reactivity Human, Mouse, Rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human ATP2A3 (1–30aa, MEAAHLLPAADVLRHFSVTAEGGLSPAQVT)
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Antigen affinity chromatography
Storage buffer PBS with 5 mg BSA
Contains 0.05 mg sodium azide
Storage conditions -20°C
Shipping conditions Ambient (domestic); Wet ice (international)
RRID AB_2745954

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Target Information

ATP-dependent calcium pumps help maintain low cytoplasmic calcium concentrations. These pumps, located in intracellular organelles, belong to the sarcoplasmic or endoplasmic reticulum calcium ATPases (SERCA) family.
The SERCA2 gene produces two isoforms: SERCA2a (muscle-specific, expressed in skeletal, cardiac, and smooth muscle) and SERCA2b (expressed in all cell types).
SERCA3 co-expresses with SERCA2b in platelets, mast cells, lymphoid cells, and epithelial cells, and is known as the non-muscle form of SERCA.


For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.