
Thermo Fisher Scientific Human FGF-19 Recombinant Protein, PeproTech
인간 유래 FGF-19 재조합 단백질로, 세포 증식 분석에 사용됩니다. E. coli 발현 시스템에서 생산되며 ≥95% 순도를 보장합니다. 분자량은 약 21.8 kDa이며, 내독소 함량은 1 EU/µg 미만입니다. 연구용으로 간 및 대사 관련 연구에 적합합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
Functional Assay (Functional)
- Assay-dependent
In vitro Assay (IV)
- Refer to 12 related publications
Miscellaneous PubMed (Misc)
- Refer to 1 related publication
Product Specifications
| 항목 | 내용 |
|---|---|
| Species | Human |
| Published species | Chicken, Hamster, Human, Mouse |
| Expression System | E. coli |
| Amino Acid Sequence | MRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVD CARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK |
| Molecular Weight | 21.8 kDa |
| Class | Recombinant |
| Type | Protein |
| Purity | ≥ 95% by SDS-PAGE and HPLC |
| Endotoxin Concentration | <1 EU/µg |
| Activity | Determined by a cell proliferation assay using balb/c 3T3 cells. Expected ED50: 100–150 ng/ml |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Purification | Purified |
| Contains | No preservative |
| Storage Conditions | -20°C |
Product Specific Information
- Catalog No. 100-32-1MG is supplied as 2 × 500 µg (100-32-500UG).
- Recombinant Human FGF-19 is a 21.8 kDa protein containing 195 amino acid residues.
- Shipped at ambient temperature.
- For storage, handling, and reconstitution details, refer to the lot-specific Certificate of Analysis.
Target Information
FGF19 (Fibroblast Growth Factor 19) is a human protein encoded by the FGF19 gene, located on chromosome 11q13.3.
It belongs to the fibroblast growth factor family and contains a signal sequence with two conserved cysteine residues.
Expression is detected in fetal brain tissue but not in adult brain.
FGF19 plays a key role in hepatic protein and glycogen synthesis without inducing lipogenesis.
Its effects are independent of insulin or Akt kinase activity, acting instead through a MAP kinase signaling pathway that promotes protein translation and glycogen synthase activation.
The mouse ortholog, FGF15, shares ~50% amino acid identity and similar biological functions. Together, they are often referred to as FGF15/19.
For Research Use Only.
Not for use in diagnostic procedures or resale without authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific Human TGF-beta 2 Recombinant Protein, PeproTech
4,713,600원

Thermo Fisher Scientific
Thermo Fisher Scientific Human FGF-5 Recombinant Protein, PeproTech
139,800원

Thermo Fisher Scientific
Thermo Fisher Scientific Human FGF-19 Recombinant Protein, PeproTech
4,522,900원

Thermo Fisher Scientific
Thermo Fisher Scientific Human FGF-4 Recombinant Protein, PeproTech
138,900원

Thermo Fisher Scientific
Thermo Fisher Scientific Peroxidase Polyclonal Antibody
679,400원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|