CacheBy
Thermo Fisher Scientific Human FGF-19 Recombinant Protein, PeproTech
원본

Thermo Fisher Scientific Human FGF-19 Recombinant Protein, PeproTech

상품 한눈에 보기

인간 유래 FGF-19 재조합 단백질로, 세포 증식 분석에 사용됩니다. E. coli 발현 시스템에서 생산되며 ≥95% 순도를 보장합니다. 분자량은 약 21.8 kDa이며, 내독소 함량은 1 EU/µg 미만입니다. 연구용으로 간 및 대사 관련 연구에 적합합니다.

카탈로그번호
100-32-01M
카테고리
Protein
판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 05. 오후 09:46
Thermo Fisher Scientific 100-32-01M Human FGF-19 Recombinant Protein, PeproTech 2 x 500 ug pk판매 단위 pk
재고 1개
4,522,900원VAT 포함 4,975,190원

Thermo Fisher Scientific · Thermo Fisher Scientific Human FGF-19 Recombinant Protein, PeproTech

Applications

Functional Assay (Functional)

  • Assay-dependent

In vitro Assay (IV)

  • Refer to 12 related publications

Miscellaneous PubMed (Misc)

  • Refer to 1 related publication

Product Specifications

항목 내용
Species Human
Published species Chicken, Hamster, Human, Mouse
Expression System E. coli
Amino Acid Sequence MRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVD CARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK
Molecular Weight 21.8 kDa
Class Recombinant
Type Protein
Purity ≥ 95% by SDS-PAGE and HPLC
Endotoxin Concentration <1 EU/µg
Activity Determined by a cell proliferation assay using balb/c 3T3 cells. Expected ED50: 100–150 ng/ml
Conjugate Unconjugated
Form Lyophilized
Purification Purified
Contains No preservative
Storage Conditions -20°C

Product Specific Information

  • Catalog No. 100-32-1MG is supplied as 2 × 500 µg (100-32-500UG).
  • Recombinant Human FGF-19 is a 21.8 kDa protein containing 195 amino acid residues.
  • Shipped at ambient temperature.
  • For storage, handling, and reconstitution details, refer to the lot-specific Certificate of Analysis.

Target Information

FGF19 (Fibroblast Growth Factor 19) is a human protein encoded by the FGF19 gene, located on chromosome 11q13.3.
It belongs to the fibroblast growth factor family and contains a signal sequence with two conserved cysteine residues.
Expression is detected in fetal brain tissue but not in adult brain.

FGF19 plays a key role in hepatic protein and glycogen synthesis without inducing lipogenesis.
Its effects are independent of insulin or Akt kinase activity, acting instead through a MAP kinase signaling pathway that promotes protein translation and glycogen synthase activation.
The mouse ortholog, FGF15, shares ~50% amino acid identity and similar biological functions. Together, they are often referred to as FGF15/19.


For Research Use Only.
Not for use in diagnostic procedures or resale without authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.