
Thermo Fisher Scientific ABCG8 Polyclonal Antibody
ABCG8 단백질을 인식하는 Rabbit Polyclonal 항체로, Western blot 및 Immunocytochemistry에 적합합니다. Human, Mouse, Rat 반응성을 가지며, 항원 친화 크로마토그래피로 정제되었습니다. Lyophilized 형태로 제공되며 재구성 후 500 µg/mL 농도로 사용 가능합니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific ABCG8 Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunocytochemistry (ICC/IF) | 5 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human ABCG8 (328–371 aa: DRRSREQELATREKAQSLAALFLEKVRDLDDFLWKAETKDLDED) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage conditions | -20°C |
| Shipping conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2745819 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
ATP-binding cassette (ABC) transporter genes regulate the amount of dietary cholesterol retained in the body. ABCG8, expressed highly in the liver and intestine, cooperates with ABCG5 to limit intestinal absorption and promote biliary excretion of sterols. Mutations in this transporter can cause sterol accumulation and lead to atherosclerosis or sitosterolemia, a rare autosomal recessive disorder characterized by hyperabsorption of sterols and inability to excrete sterols into bile.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.
