Thermo Fisher Scientific ABCG8 Polyclonal Antibody
ABCG8 단백질을 인식하는 Rabbit Polyclonal 항체로, Western blot 및 Immunocytochemistry에 적합합니다. Human, Mouse, Rat 반응성을 가지며, 항원 친화 크로마토그래피로 정제되었습니다. Lyophilized 형태로 제공되며 재구성 후 500 µg/mL 농도로 사용 가능합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunocytochemistry (ICC/IF) | 5 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human ABCG8 (328–371 aa: DRRSREQELATREKAQSLAALFLEKVRDLDDFLWKAETKDLDED) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage conditions | -20°C |
| Shipping conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2745819 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
ATP-binding cassette (ABC) transporter genes regulate the amount of dietary cholesterol retained in the body. ABCG8, expressed highly in the liver and intestine, cooperates with ABCG5 to limit intestinal absorption and promote biliary excretion of sterols. Mutations in this transporter can cause sterol accumulation and lead to atherosclerosis or sitosterolemia, a rare autosomal recessive disorder characterized by hyperabsorption of sterols and inability to excrete sterols into bile.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific ABR Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific ABHD5 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific ABCG8 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific ABCG5 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific ABCE1 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|