Thermo Fisher Scientific ABR Polyclonal Antibody
ABR 단백질을 인식하는 Rabbit Polyclonal Antibody로 Western blot 및 IHC(P) 적용 가능. 합성 펩타이드 면역원으로 제작되었으며, 항원 친화 크로마토그래피로 정제됨. 동결건조 형태로 제공되며, 재구성 시 500 µg/mL 농도. 연구용으로만 사용 가능.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human ABR (370–407 aa: HPFPDHELEDMKMKISALKSEIQKEKANKGQSRAIERL) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | −20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2745824 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The ABR gene encodes a protein similar to the breakpoint cluster region gene on chromosome 22. This protein includes a GTPase-activating domain found in Rho family GTP-binding proteins. Functional studies in mice indicate a role in vestibular morphogenesis, suggesting Rho-related GTPases contribute to motor coordination and balance. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific ABI1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific ABI1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific ABR Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific ABHD5 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific ABCG8 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|