Thermo Fisher Scientific ACSL5 Polyclonal Antibody
ACSL5 단백질을 인식하는 Thermo Fisher Scientific의 폴리클로날 항체입니다. Western blot에 적합하며 인간, 마우스, 랫트에서 반응합니다. 항원 친화 크로마토그래피로 정제된 고품질 항체로, 지방산 대사 연구 및 암 관련 연구에 활용 가능합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Thermo Fisher Scientific ACSL5 Polyclonal Antibody
Applications
- Western Blot (WB): 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to human ACSL5 (337–378aa ADDMKTLKPTLFPAVPRLLNRIYDKVQNEAKTPLKKFLLKLA) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2745830 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The ACSL5 gene encodes an isozyme of the long-chain fatty-acid-coenzyme A ligase family. These enzymes convert free long-chain fatty acids into fatty acyl-CoA esters, playing a key role in lipid biosynthesis and fatty acid degradation.
ACSL5 is highly expressed in uterus and spleen, with trace expression in normal brain, but significantly elevated in malignant gliomas. It mediates fatty acid-induced glioma cell growth. Three transcript variants encoding two different isoforms have been identified.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific ATP Citrate Lyase Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific ACSL1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific ACSL5 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific ACE Polyclonal Antibody
565,000원
Thermo Fisher Scientific
Thermo Fisher Scientific ACADVL Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|