Thermo Fisher Scientific ACSL5 Polyclonal Antibody
ACSL5 단백질을 인식하는 Thermo Fisher Scientific의 폴리클로날 항체입니다. Western blot에 적합하며 인간, 마우스, 랫트에서 반응합니다. 항원 친화 크로마토그래피로 정제된 고품질 항체로, 지방산 대사 연구 및 암 관련 연구에 활용 가능합니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific ACSL5 Polyclonal Antibody
Thermo Fisher Scientific ACSL5 Polyclonal Antibody
Applications
- Western Blot (WB): 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to human ACSL5 (337–378aa ADDMKTLKPTLFPAVPRLLNRIYDKVQNEAKTPLKKFLLKLA) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2745830 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The ACSL5 gene encodes an isozyme of the long-chain fatty-acid-coenzyme A ligase family. These enzymes convert free long-chain fatty acids into fatty acyl-CoA esters, playing a key role in lipid biosynthesis and fatty acid degradation.
ACSL5 is highly expressed in uterus and spleen, with trace expression in normal brain, but significantly elevated in malignant gliomas. It mediates fatty acid-induced glioma cell growth. Three transcript variants encoding two different isoforms have been identified.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.