원본
Thermo Fisher Scientific ACADVL Polyclonal Antibody
상품 한눈에 보기
ACADVL 단백질을 인식하는 토끼 폴리클로날 항체로, Western blot에 적합합니다. 인간 및 랫트 시료에 반응하며, 항원 친화 크로마토그래피로 정제되었습니다. 동결건조 형태로 제공되며, 재구성 시 500 µg/mL 농도를 제공합니다.
- 카탈로그번호
- PA578710
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 04. 오후 06:55
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA578710 ACADVL Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원
Thermo Fisher Scientific · Thermo Fisher Scientific ACADVL Polyclonal Antibody
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human ACADVL (538–576aa RALEQFATVVEAKLIKHKKGIVNEQFLLQRLADGAIDLY) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage conditions | -20°C |
| Shipping conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2745826 |
Product Specific Information
- Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The protein encoded by this gene is localized to the inner mitochondrial membrane and catalyzes the first step of the mitochondrial fatty acid beta-oxidation pathway. This acyl-Coenzyme A dehydrogenase acts specifically on long-chain and very-long-chain fatty acids. Deficiency in this gene product reduces myocardial fatty acid beta-oxidation and is associated with cardiomyopathy. Alternative splicing results in multiple transcript variants encoding different isoforms.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific ACSL5 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific ACE Polyclonal Antibody565,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific ACAA2 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific ABL2 Polyclonal Antibody568,000원VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.