
Atlas Antibodies Anti-SPDL1 Antibody
인간 SPDL1 단백질을 인식하는 폴리클로날 항체로, IHC 및 RNA-seq 데이터를 통한 직교 검증 완료. 토끼 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제됨. 인간에 특이적으로 반응하며, 세포 분열 관련 연구에 적합.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SPDL1 Antibody
Target: spindle apparatus coiled-coil protein 1 (SPDL1)
Type: Polyclonal Antibody against Human SPDL1
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody raised in rabbit against human SPDL1 (spindle apparatus coiled-coil protein 1).
Alternative Gene Names
CCDC99, FLJ20364, hSpindly
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
- Antigen Sequence:
YEPEETVEVPVLKKRREVLPVDITTAKDACVNNSALGGEVYRLPPQKEETQSCPNSLEDNNLQLEKSVSIHTPVVSLSPHKNLPVDMQLKKEKKCVKLIGVPADA
Verified Species Reactivity
- Human
Interspecies Information
| Species | Ortholog ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000069910 | 55% |
| Rat | ENSRNOG00000007292 | 50% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SPEF1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SPEF2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SPDL1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SPECC1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SPECC1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|