
Atlas Antibodies Anti-SPEF1 Antibody
상품 한눈에 보기
Human SPEF1 단백질을 인식하는 폴리클로날 토끼 항체로, 정자 편모 단백질 연구에 적합. IHC 기반 Orthogonal validation으로 검증됨. PrEST 항원으로 친화 정제된 고품질 항체. 인간, 생쥐, 랫트 간 교차 반응성 확인.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SPEF1 Antibody
Target: sperm flagellar 1 (SPEF1)
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human SPEF1
Alternative Gene Names
C20orf28, DKFZP434I114, SPEF1A
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | sperm flagellar 1 |
| Target Gene | SPEF1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000021247 (83%), Mouse ENSMUSG00000027329 (83%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
Antigen Sequence
RDFSDGVLVAEVIKFYFPKMVEMHNYVPANSLQQKLSNWGHLNRKVLKRLNFSVPDDVMRKIAQCAPGVVELVLIPLRQRLEERQRRRKQGAGSLQELAPQDGSGYMDVGKVAFSISPSRL제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SPEN Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SPECC1L Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SPEF1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SPEF2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SPDL1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.