CacheBy
Atlas Antibodies Anti-SPECC1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SPECC1 Antibody

상품 한눈에 보기

Atlas Antibodies의 Anti-SPECC1 Rabbit Polyclonal Antibody로 인간 및 생쥐 SPECC1 단백질 검출에 적합. IHC 및 WB 검증 완료. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. PBS/glycerol 버퍼에 보존제 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA021430-100 Anti-SPECC1 Antibody, sperm antigen with calponin homology and coiled-coil domains 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA021430-25 Anti-SPECC1 Antibody, sperm antigen with calponin homology and coiled-coil domains 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SPECC1 Antibody

Anti-SPECC1 Antibody

Target: sperm antigen with calponin homology and coiled-coil domains 1 (SPECC1)
Supplier: Atlas Antibodies


  • IHC (Independent Validation): Validation of protein expression in immunohistochemistry by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Western Blot)

Product Description

Polyclonal Antibody against Human SPECC1


Alternative Gene Names

CYTSB, FLJ36955, HCMOGT-1, NSP

Open Datasheet


Target Information

항목 내용
Target Protein sperm antigen with calponin homology and coiled-coil domains 1
Target Gene SPECC1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence DTEPMIRALEEKNKNFQKELSDLEEENRVLKEKLIYLEHSPNSEGAASHTGDSSCPTSITQESSFGSPTGNQMSSD
Verified Species Reactivity Human, Mouse
Interspecies Information Rat ENSRNOG00000002903 (84%), Mouse ENSMUSG00000042331 (82%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent Validation
Independent Validation Tooltip
Western Blot

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.