
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-SPECC1 Antibody
상품 한눈에 보기
인간 SPECC1 단백질을 타깃으로 하는 폴리클로날 항체로, IHC와 WB 실험에 적합합니다. 토끼 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. 인간 및 생쥐 반응성이 검증되어 다양한 생물학적 연구에 활용 가능합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA061073-100 Anti-SPECC1 Antibody, sperm antigen with calponin homology and coiled-coil domains 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA061073-25 Anti-SPECC1 Antibody, sperm antigen with calponin homology and coiled-coil domains 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SPECC1 Antibody
Anti-SPECC1 Antibody
Full Name: Sperm antigen with calponin homology and coiled-coil domains 1
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Independent Antibody Validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
- WB (Western Blot)
Product Description
Polyclonal antibody against Human SPECC1.
Alternative Gene Names
CYTSB, FLJ36955, HCMOGT-1, NSP
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Sperm antigen with calponin homology and coiled-coil domains 1 |
| Target Gene | SPECC1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | DTEPMIRALEEKNKNFQKELSDLEEENRVLKEKLIYLEHSPNSEGAASHTGDSSCPTSITQESSFGSPTGNQMSSD |
Verified Species Reactivity
- Human
- Mouse
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000002903 (84%)
- Mouse ENSMUSG00000042331 (82%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



