CacheBy
Atlas Antibodies Anti-SPECC1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SPECC1 Antibody

상품 한눈에 보기

인간 SPECC1 단백질을 타깃으로 하는 폴리클로날 항체로, IHC와 WB 실험에 적합합니다. 토끼 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. 인간 및 생쥐 반응성이 검증되어 다양한 생물학적 연구에 활용 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA061073-100 Anti-SPECC1 Antibody, sperm antigen with calponin homology and coiled-coil domains 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA061073-25 Anti-SPECC1 Antibody, sperm antigen with calponin homology and coiled-coil domains 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SPECC1 Antibody

Anti-SPECC1 Antibody

Full Name: Sperm antigen with calponin homology and coiled-coil domains 1
Supplier: Atlas Antibodies


  • IHC (Independent Antibody Validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Western Blot)

Product Description

Polyclonal antibody against Human SPECC1.


Alternative Gene Names

CYTSB, FLJ36955, HCMOGT-1, NSP

Open Datasheet


Target Information

항목 내용
Target Protein Sperm antigen with calponin homology and coiled-coil domains 1
Target Gene SPECC1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence DTEPMIRALEEKNKNFQKELSDLEEENRVLKEKLIYLEHSPNSEGAASHTGDSSCPTSITQESSFGSPTGNQMSSD

Verified Species Reactivity

  • Human
  • Mouse

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000002903 (84%)
  • Mouse ENSMUSG00000042331 (82%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent Validation
Independent Validation Tooltip
WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.