
Atlas Antibodies Anti-SPATC1L Antibody
상품 한눈에 보기
인간 SPATC1L 단백질을 인식하는 폴리클로날 항체로, 정자형성과 중심체 관련 단백질 연구에 적합합니다. WB와 ICC에서 재조합 발현 검증 완료. 토끼 유래 IgG로 고순도 친화 정제되어 안정적인 성능을 제공합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SPATC1L Antibody
Target: Spermatogenesis and centriole associated 1-like (SPATC1L)
Supplier: Atlas Antibodies
Recommended Applications
- WB (Recombinant Expression): Validation using target protein overexpression
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human SPATC1L
Alternative Gene Names
- C21orf56
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Spermatogenesis and centriole associated 1-like |
| Target Gene | SPATC1L |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat (92%, ENSRNOG00000045929), Mouse (92%, ENSMUSG00000009115) |
Antigen Sequence:GSVDERKLRELTQRYLALSARLEKLGYSRDVHPAFSEFLINTYGILKQRPDLRANPLHSSPAALRKLVIDVVPPKFLGDSLLLLNCLCELSKEDGKPLF
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SPATA9 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SPATA9 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SPATC1L Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SPATA6L Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SPATA7 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.