
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-SPATC1L Antibody
상품 한눈에 보기
인간 SPATC1L 단백질을 인식하는 폴리클로날 항체로, 정자형성과 중심체 관련 단백질 연구에 적합합니다. WB와 ICC에서 재조합 발현 검증 완료. 토끼 유래 IgG로 고순도 친화 정제되어 안정적인 성능을 제공합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA029394-100 Anti-SPATC1L Antibody, spermatogenesis and centriole associated 1-like 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA029394-25 Anti-SPATC1L Antibody, spermatogenesis and centriole associated 1-like 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SPATC1L Antibody
Anti-SPATC1L Antibody
Target: Spermatogenesis and centriole associated 1-like (SPATC1L)
Supplier: Atlas Antibodies
Recommended Applications
- WB (Recombinant Expression): Validation using target protein overexpression
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human SPATC1L
Alternative Gene Names
- C21orf56
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Spermatogenesis and centriole associated 1-like |
| Target Gene | SPATC1L |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat (92%, ENSRNOG00000045929), Mouse (92%, ENSMUSG00000009115) |
Antigen Sequence:GSVDERKLRELTQRYLALSARLEKLGYSRDVHPAFSEFLINTYGILKQRPDLRANPLHSSPAALRKLVIDVVPPKFLGDSLLLLNCLCELSKEDGKPLF
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



