CacheBy
Atlas Antibodies Anti-SPATA9 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SPATA9 Antibody

상품 한눈에 보기

인체 SPATA9 단백질을 표적으로 하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. 재조합 단백질 발현 검증을 통해 신뢰성 확보. 토끼 유래 IgG 형태로 PrEST 항원 친화 정제 방식 사용.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA076967-100 Anti-SPATA9 Antibody, spermatogenesis associated 9 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA076967-25 Anti-SPATA9 Antibody, spermatogenesis associated 9 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SPATA9 Antibody

Anti-SPATA9 Antibody

Target Protein: Spermatogenesis associated 9 (SPATA9)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB) – Recombinant expression validation using target protein overexpression
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human SPATA9.


Alternative Gene Names

FLJ35906, NYD-SP16

Open Datasheet (PDF)


Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

LKKVKNIFQEEESIRQNREESENCRKAFSEPVLSEPMFAEGEIKAKPYRSLPEKPDISDYPKLLANKQSNNIQVLHSVFDQSAEMNEQI

Verified Species Reactivity

Human


Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000012770 81%
Mouse ENSMUSG00000021590 77%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Recombinant Expression
Recombinant Expression Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.